|
Bioinformatics FAQ
There are a large number of bioinformatics programs available to CBRG account holders via this web site. These
examples (Frequently Asked Questions) are used to illustrate the use of these tools
in answering typical queries posed by researchers.
The major web-based tools from the CBRG are listed, here.
How can I search for transmembrane domains?
Program name: tmap
Example output from tmap (using: "Output report format = DbMotif" and MHC class I antigen A protein sequence
(UniProt_SwissProt:P30443)
# Sequence: 1A01_HUMAN from: 1 to: 365
# HitCount: 2
#=======================================
Length = 29
Start = position 5 of sequence
End = position 33 of sequence
TransMem = 1
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSR
| |
5 33
Length = 29
Start = position 303 of sequence
End = position 331 of sequence
TransMem = 2
WELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKS
| |
303 331
#---------------------------------------
Further reading: tmap background
Back to FAQs
|
